Recombinant Human RNASE7 protein, GST-tagged

• Cat.No.: RNASE7-29H
• Product Overview: Recombinant Human RNASE7(1 a.a. - 156 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• ProteinLength: 1-156 a.a.
• Description: The protein encoded by this gene belongs to the pancreatic ribonuclease family, a subset of the ribonuclease A superfamily. The protein has broad-spectrum antimicrobial activity against bacteria and fungi.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 43.9 kDa
• AA Sequence: MAPARAGFCPLLLLLLLGLWVAEIPVSAKPKGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEP FSSVAATCQTPKIACKNGDKNCHQSHGPVSLTMCKLTSGKYPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPV HLDRVL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: RNASE7 ribonuclease, RNase A family, 7 [ Homo sapiens ]
• Official Symbol: RNASE7
• Synonyms: RNASE7; ribonuclease, RNase A family, 7; ribonuclease 7; SAP-2; RNase 7; skin-derived antimicrobial protein 2; MGC133220
• Gene ID: 84659
• mRNA Refseq: NM_032572
• Protein Refseq: NP_115961
• MIM: 612484
• UniProt ID: Q9H1E1
• Chromosome Location: 14q11.1
• Function: endonuclease activity; hydrolase activity; nucleic acid binding; pancreatic ribonuclease activity; ribonuclease activity