Recombinant Human RNASE7 protein, GST-tagged

Cat.No. : RNASE7-29H
Product Overview : Recombinant Human RNASE7(1 a.a. - 156 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-156 a.a.
Description : The protein encoded by this gene belongs to the pancreatic ribonuclease family, a subset of the ribonuclease A superfamily. The protein has broad-spectrum antimicrobial activity against bacteria and fungi.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 43.9 kDa
AA Sequence : MAPARAGFCPLLLLLLLGLWVAEIPVSAKPKGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEP FSSVAATCQTPKIACKNGDKNCHQSHGPVSLTMCKLTSGKYPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPV HLDRVL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name RNASE7 ribonuclease, RNase A family, 7 [ Homo sapiens ]
Official Symbol RNASE7
Synonyms RNASE7; ribonuclease, RNase A family, 7; ribonuclease 7; SAP-2; RNase 7; skin-derived antimicrobial protein 2; MGC133220;
Gene ID 84659
mRNA Refseq NM_032572
Protein Refseq NP_115961
MIM 612484
UniProt ID Q9H1E1
Chromosome Location 14q11.1
Function endonuclease activity; hydrolase activity; nucleic acid binding; pancreatic ribonuclease activity; ribonuclease activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RNASE7 Products

Required fields are marked with *

My Review for All RNASE7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon