Recombinant Human RNASE1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RNASE1-3424H
• Product Overview: RNASE1 MS Standard C13 and N15-labeled recombinant protein (NP_937878) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases. It prefers poly(C) as a substrate and hydrolyzes 2',3'-cyclic nucleotides, with a pH optimum near 8.0. The encoded protein is monomeric and more commonly acts to degrade ds-RNA over ss-RNA. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified.
• Molecular Mass: 17.6 kDa
• AA Sequence: MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDSTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RNASE1 ribonuclease A family member 1, pancreatic [ Homo sapiens (human) ]
• Official Symbol: RNASE1
• Synonyms: RNASE1; ribonuclease, RNase A family, 1 (pancreatic); RNS1; ribonuclease pancreatic; RIB-1; RNase 1; RNase A; HP-RNase; RNase upI-1; ribonuclease 1; ribonuclease A; RIB1; MGC12408
• Gene ID: 6035
• mRNA Refseq: NM_198235
• Protein Refseq: NP_937878
• MIM: 180440
• UniProt ID: P07998