Recombinant Human RHOG protein, His-tagged

• Cat.No.: RHOG-683H
• Product Overview: Recombinant Human RHOG protein(NP_001656)(74-191 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 74-191 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: QTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSCILL
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: RHOG ras homolog family member G [ Homo sapiens ]
• Official Symbol: RHOG
• Synonyms: RHOG; ras homolog family member G; ARHG, ras homolog gene family, member G (rho G); rho-related GTP-binding protein RhoG; MGC125835; MGC125836; RhoG; ras homolog gene family, member G (rho G); ARHG
• Gene ID: 391
• mRNA Refseq: NM_001665
• Protein Refseq: NP_001656
• MIM: 179505
• UniProt ID: P84095