Recombinant Human RHOD protein, His&Myc-tagged

• Cat.No.: RHOD-4518H
• Product Overview: Recombinant Human RHOD protein(O00212)(1-207aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 30.6 kDa
• Protein length: 1-207aa
• AA Sequence: MTAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQVKGKPVHLHIWDTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLCKDKSLVNKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRGRNFWRRITQGFC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: RHOD ras homolog family member D [ Homo sapiens ]
• Official Symbol: RHOD
• Synonyms: RHOD; ras homolog family member D; ARHD, ras homolog gene family, member D; rho-related GTP-binding protein RhoD; Rho; Rho related GTP binding protein RhoD; Rho related protein HP1; RhoD; RhoHP1; ras homolog D; Rho-related protein HP1; ras homolog gene family, member A; ras homolog gene family, member D; ARHD; RHOM; RHOHP1
• Gene ID: 29984
• mRNA Refseq: NM_014578
• Protein Refseq: NP_055393
• MIM: 605781
• UniProt ID: O00212