Recombinant Human RHOC, His-tagged

• Cat.No.: RHOC-30285TH
• Product Overview: Recombinant full length mature Human RHOC with N terminal His tag; 210 amino acids inclusive of tag, Predicted MWt 23.8 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 190 amino acids
• Description: This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.
• Conjugation: HIS
• Molecular Weight: 23.800kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 0.1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGC
• Sequence Similarities: Belongs to the small GTPase superfamily. Rho family.

Gene Information

• Gene Name: RHOC ras homolog gene family, member C [ Homo sapiens ]
• Official Symbol: RHOC
• Synonyms: RHOC; ras homolog gene family, member C; ARH9, ARHC; rho-related GTP-binding protein RhoC; RhoC
• Gene ID: 389
• mRNA Refseq: NM_001042678
• Protein Refseq: NP_001036143
• MIM: 165380
• Uniprot ID: P08134
• Chromosome Location: 1p13.1
• Pathway: Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; G alpha (12/13) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Rho GTPase cycle, organism-specific biosystem
• Function: GTP binding; GTPase activity; nucleotide binding; protein domain specific binding; signal transducer activity