Recombinant Full Length Human RHOC protein, GST-tagged

• Cat.No.: RHOC-301274H
• Product Overview: Recombinant Human RHOC (1-193 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-193 a.a.
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: RHOC ras homolog family member C [ Homo sapiens ]
• Official Symbol: RHOC
• Synonyms: RHOC; ras homolog family member C; ARH9, ARHC, ras homolog gene family, member C; rho-related GTP-binding protein RhoC; RhoC; rhoC GTPase; oncogene RHO H9; rho cDNA clone 9; RAS-related homolog 9; small GTP binding protein RhoC; ras homolog gene family, member C; H9; ARH9; ARHC; RHOH9; MGC1448; MGC61427
• Gene ID: 389
• mRNA Refseq: NM_001042678
• Protein Refseq: NP_001036143
• MIM: 165380
• UniProt ID: P08134