Recombinant Human RHOB Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RHOB-4495H
• Product Overview: RHOB MS Standard C13 and N15-labeled recombinant protein (NP_004031) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: RHOB (Ras Homolog Family Member B) is a Protein Coding gene. Diseases associated with RHOB include Pancreatic Adenocarcinoma and Cardiomyopathy, Familial Hypertrophic, 1. Among its related pathways are Guidance Cues and Growth Cone Motility and Signaling by GPCR. Gene Ontology (GO) annotations related to this gene include GTP binding and GDP binding. An important paralog of this gene is RHOA.
• Molecular Mass: 22.1 kDa
• AA Sequence: MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RHOB ras homolog family member B [ Homo sapiens (human) ]
• Official Symbol: RHOB
• Synonyms: RHOB; ras homolog family member B; ARH6, ARHB, ras homolog gene family, member B; rho-related GTP-binding protein RhoB; MST081; oncogene RHO H6; RhoB; RHOH6; h6; rho cDNA clone 6; Aplysia RAS-related homolog 6; ras homolog gene family, member B; ARH6; ARHB; MSTP081
• Gene ID: 388
• mRNA Refseq: NM_004040
• Protein Refseq: NP_004031
• MIM: 165370
• UniProt ID: P62745