Recombinant Human RHOB protein, His-tagged

• Cat.No.: RHOB-2121H
• Product Overview: Recombinant Human RHOB protein(1-196 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: His
• Protein Length: 1-196 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL
• Purity: 85%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: RHOB ras homolog family member B [ Homo sapiens ]
• Official Symbol: RHOB
• Synonyms: RHOB; ras homolog family member B; ARH6, ARHB, ras homolog gene family, member B; rho-related GTP-binding protein RhoB; MST081; oncogene RHO H6; RhoB; RHOH6; h6; rho cDNA clone 6; Aplysia RAS-related homolog 6; ras homolog gene family, member B; ARH6; ARHB; MSTP081
• mRNA Refseq: NM_004040
• Protein Refseq: NP_004031
• MIM: 165370
• UniProt ID: P62745
• Gene ID: 388