Recombinant Human RHOB, His-tagged

• Cat.No.: RHOB-27380TH
• Product Overview: Recombinant full length Human mature RHOB with an N terminal His tag; 213 amino acids, predicted MWt 23.9kDa.

Specification

• Description: Mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation.
• Protein length: 193 amino acids
• Conjugation: HIS
• Molecular Weight: 23.900kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCC
• Sequence Similarities: Belongs to the small GTPase superfamily. Rho family.

Gene Information

• Gene Name: RHOB ras homolog gene family, member B [ Homo sapiens ]
• Official Symbol: RHOB
• Synonyms: RHOB; ras homolog gene family, member B; ARH6, ARHB; rho-related GTP-binding protein RhoB; MST081; oncogene RHO H6; RhoB; RHOH6
• Gene ID: 388
• mRNA Refseq: NM_004040
• Protein Refseq: NP_004031
• MIM: 165370
• Uniprot ID: P62745
• Chromosome Location: 2p24
• Pathway: Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; G alpha (12/13) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem
• Function: GDP binding; GTP binding; GTPase activity; nucleotide binding; protein binding