Recombinant Human RGS5 protein, GST-tagged

• Cat.No.: RGS5-6843H
• Product Overview: Recombinant Human RGS5 protein(7-74 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 7-74 aa
• Tag: N-GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: ALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYG

Gene Information

• Gene Name: RGS5 regulator of G-protein signaling 5 [ Homo sapiens ]
• Official Symbol: RGS5
• Synonyms: RGS5; regulator of G-protein signaling 5; regulator of G protein signalling 5; MST092; MST106; MST129; MSTP032; MSTP092; MSTP106; MSTP129
• Gene ID: 8490
• mRNA Refseq: NM_001195303
• Protein Refseq: NP_001182232
• MIM: 603276
• UniProt ID: O15539