Recombinant Human RGS4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RGS4-1188H |
Product Overview : | RGS4 MS Standard C13 and N15-labeled recombinant protein (NP_005604) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 4 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. Regulator of G protein signaling 4 protein is 37% identical to RGS1 and 97% identical to rat Rgs4. This protein negatively regulate signaling upstream or at the level of the heterotrimeric G protein and is localized in the cytoplasm. Alternatively spliced transcript variants have been found for this gene. |
Molecular Mass : | 23.3 kDa |
AA Sequence : | MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RGS4 regulator of G-protein signaling 4 [ Homo sapiens (human) ] |
Official Symbol | RGS4 |
Synonyms | RGS4; regulator of G-protein signaling 4; regulator of G protein signalling 4, schizophrenia disorder 9, SCZD9; schizophrenia disorder 9; RGP4; SCZD9; MGC2124; MGC60244; DKFZp761F1924; |
Gene ID | 5999 |
mRNA Refseq | NM_005613 |
Protein Refseq | NP_005604 |
MIM | 602516 |
UniProt ID | P49798 |
◆ Recombinant Proteins | ||
RGS4-1887H | Recombinant Human RGS4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RGS4-301208H | Recombinant Human RGS4 protein, GST-tagged | +Inquiry |
RGS4-5020R | Recombinant Rat RGS4 Protein | +Inquiry |
RGS4-14145M | Recombinant Mouse RGS4 Protein | +Inquiry |
RGS4-7568M | Recombinant Mouse RGS4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RGS4-2372HCL | Recombinant Human RGS4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RGS4 Products
Required fields are marked with *
My Review for All RGS4 Products
Required fields are marked with *
0
Inquiry Basket