Recombinant Human RGS4 protein, GST-tagged
Cat.No. : | RGS4-301208H |
Product Overview : | Recombinant Human RGS4 (21-71 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | His21-Cys71 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | HRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHEC |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RGS4 regulator of G-protein signaling 4 [ Homo sapiens ] |
Official Symbol | RGS4 |
Synonyms | RGS4; regulator of G-protein signaling 4; regulator of G protein signalling 4 , schizophrenia disorder 9 , SCZD9; schizophrenia disorder 9; RGP4; SCZD9; MGC2124; MGC60244; DKFZp761F1924; |
Gene ID | 5999 |
mRNA Refseq | NM_001102445 |
Protein Refseq | NP_001095915 |
MIM | 602516 |
UniProt ID | P49798 |
◆ Recombinant Proteins | ||
RGS4-6177H | Recombinant Human RGS4 Protein (Ser38-Ala205), N-His tagged | +Inquiry |
RGS4-3616H | Recombinant Full Length Human RGS4 Protein, His-tagged | +Inquiry |
Rgs4-5499M | Recombinant Mouse Rgs4 Protein, Myc/DDK-tagged | +Inquiry |
RGS4-1887H | Recombinant Human RGS4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RGS4-9906Z | Recombinant Zebrafish RGS4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RGS4-2372HCL | Recombinant Human RGS4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RGS4 Products
Required fields are marked with *
My Review for All RGS4 Products
Required fields are marked with *
0
Inquiry Basket