Recombinant Human RERGL Protein, GST-tagged

• Cat.No.: RERGL-4278H
• Product Overview: Human FLJ22655 full-length ORF ( NP_079006.1, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: RERGL (RERG Like) is a Protein Coding gene. GO annotations related to this gene include GTP binding. An important paralog of this gene is RASL11A.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 50.3 kDa
• AA Sequence: MSNFLHLKYNEKSVSVTKALTVRFLTKRFIGEYASNFESIYKKHLCLERKQLNLEIYDPCSQTQKAKFSLTSELHWADGFVIVYDISDRSSFAFAKALIYRIREPQTSHCKRAVESAVFLVGNKRDLCHVREVGWEEGQKLALENRCQFCELSAAEQSLEVEMMFIRIIKDILINFKLKEKRRPSGSKSMAKLINNVFGKRRKSV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RERGL RERG/RAS-like [ Homo sapiens ]
• Official Symbol: RERGL
• Synonyms: RERGL; RERG/RAS-like; ras-related and estrogen-regulated growth inhibitor-like protein; FLJ22655; RERG/Ras-like protein
• Gene ID: 79785
• mRNA Refseq: NM_024730
• Protein Refseq: NP_079006
• UniProt ID: Q9H628