Recombinant Full Length Human RERGL Protein, GST-tagged
Cat.No. : | RERGL-4955HF |
Product Overview : | Human FLJ22655 full-length ORF ( NP_079006.1, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | RERGL (RERG Like) is a Protein Coding gene. GO annotations related to this gene include GTP binding. An important paralog of this gene is RASL11A. |
Source : | In Vitro Cell Free System |
Species : | Human |
Tag : | GST |
Molecular Mass : | 50.3 kDa |
Protein length : | 205 amino acids |
AA Sequence : | MSNFLHLKYNEKSVSVTKALTVRFLTKRFIGEYASNFESIYKKHLCLERKQLNLEIYDPCSQTQKAKFSLTSELHWADGFVIVYDISDRSSFAFAKALIYRIREPQTSHCKRAVESAVFLVGNKRDLCHVREVGWEEGQKLALENRCQFCELSAAEQSLEVEMMFIRIIKDILINFKLKEKRRPSGSKSMAKLINNVFGKRRKSV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | RERGL RERG/RAS-like [ Homo sapiens ] |
Official Symbol | RERGL |
Synonyms | RERGL; RERG/RAS-like; ras-related and estrogen-regulated growth inhibitor-like protein; FLJ22655; RERG/Ras-like protein; |
Gene ID | 79785 |
mRNA Refseq | NM_024730 |
Protein Refseq | NP_079006 |
UniProt ID | Q9H628 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All RERGL Products
Required fields are marked with *
My Review for All RERGL Products
Required fields are marked with *
0
Inquiry Basket