Recombinant Human RELA, C-Terminal Truncated
Cat.No. : | RELA-627TH |
Product Overview : | The recombinant human NF-kB p65 protein contains amino acids 1-537, corresponding to GenBank no AA36408.1. This represents a C-terminal truncation of 14 amino acids; the full-length human p65 NF-kB protein is 551 amino acids. |
Availability | March 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Protein Length : | 1-537 a.a. |
Description : | NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene. |
Purity : | The protein was purified by affinity chromatography. The purity is greater than 98.0%. |
Formulation : | Supplied asliquid. 5 ug protein in 10 ul (0.5 ug/ul) in Tris-HCL, 0.2 M NaCl, 2 mM MgCl2, 0.2 mM EDTA, 1M DTT. |
Stability : | For long-term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please avoid freeze-thaw cycles. |
Biological Activity : | The biological activity of this protein or its ability to bind to DNA has not been established. |
Amino Acid Sequence : | MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLPHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEAL LQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPML MEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSI |
Publications : |
Quantitation of the Dynamic Profiles of the Innate Immune Response Using Multiplex Selected Reaction Monitoring–Mass Spectrometry (2013)
|
Gene Name | RELA v-rel reticuloendotheliosis viral oncogene homolog A (avian) [ Homo sapiens ] |
Official Symbol | RELA |
Synonyms | RELA; v-rel reticuloendotheliosis viral oncogene homolog A (avian); p65; NFKB3; transcription factor p65; NF-kappa-B p65delta3; nuclear factor NF-kappa-B p65 subunit; nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 ;OTTHUMP00000233474; OTTHUMP00000233475; OTTHUMP00000233475; OTTHUMP00000233900; OTTHUMP00000233473; MGC131774; light polypeptide gene enhancer in B-cells 3, p65 |
Gene ID | 5970 |
mRNA Refseq | NM_001145138 |
Protein Refseq | NP_001138610 |
MIM | 164014 |
UniProt ID | Q04206 |
Chromosome Location | 11q13 |
Pathway | Activated TLR4 signalling;Acute myeloid leukemia;Angiopoietin receptor Tie2-mediated signaling; B Cell Receptor Signaling Pathway; Cytokine Signaling in Immune system |
◆ Recombinant Proteins | ||
RELA-248Z | Recombinant Zebrafish RELA | +Inquiry |
RELA-627TH | Recombinant Human RELA, C-Terminal Truncated | +Inquiry |
RELA-1878H | Recombinant Human RELA Protein, His (Fc)-Avi-tagged | +Inquiry |
RELA-11HFL | Active Recombinant Full Length Human RELA Protein, C-Flag-tagged | +Inquiry |
RELA-611H | Recombinant Human RELA protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RELA-2423HCL | Recombinant Human RELA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RELA Products
Required fields are marked with *
My Review for All RELA Products
Required fields are marked with *
0
Inquiry Basket