Recombinant Human REG3A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: REG3A-3986H
• Product Overview: REG3A MS Standard C13 and N15-labeled recombinant protein (NP_620355) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver carcinogenesis. The mature protein also functions as an antimicrobial protein with antibacterial activity. Alternate splicing results in multiple transcript variants that encode the same protein.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 19.4 kDa
• AA Sequence: MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: REG3A regenerating islet-derived 3 alpha [ Homo sapiens (human) ]
• Official Symbol: REG3A
• Synonyms: REG3A; regenerating islet-derived 3 alpha; pancreatitis associated protein, PAP; regenerating islet-derived protein 3-alpha; HIP; PAP1; PBCGF; REG III; REG3; REG-3-alpha; reg III-alpha; PAP homologous protein; human proislet peptide; pancreatitis-associated protein 1; proliferation-inducing protein 34; proliferation-inducing protein 42; hepatocarcinoma-intestine-pancreas; pancreatic beta cell growth factor; regenerating islet-derived protein III-alpha; PAP; PAP-H; REG-III; FLJ18565
• Gene ID: 5068
• mRNA Refseq: NM_138938
• Protein Refseq: NP_620355
• MIM: 167805
• UniProt ID: Q06141