Recombinant Human REG3A protein, GST-tagged
Cat.No. : | REG3A-3417H |
Product Overview : | Recombinant Human REG3A protein(Q06141)(27-175aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | GST |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.6 kDa |
Protein length : | 27-175aa |
AA Sequence : | EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | REG3A regenerating islet-derived 3 alpha [ Homo sapiens ] |
Official Symbol | REG3A |
Synonyms | REG3A; regenerating islet-derived 3 alpha; pancreatitis associated protein , PAP; regenerating islet-derived protein 3-alpha; HIP; PAP1; PBCGF; REG III; REG3; REG-3-alpha; reg III-alpha; PAP homologous protein; human proislet peptide; pancreatitis-associated protein 1; proliferation-inducing protein 34; proliferation-inducing protein 42; hepatocarcinoma-intestine-pancreas; pancreatic beta cell growth factor; regenerating islet-derived protein III-alpha; PAP; PAP-H; REG-III; FLJ18565; |
Gene ID | 5068 |
mRNA Refseq | NM_002580 |
Protein Refseq | NP_002571 |
MIM | 167805 |
UniProt ID | Q06141 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All REG3A Products
Required fields are marked with *
My Review for All REG3A Products
Required fields are marked with *
0
Inquiry Basket