Recombinant Human REG3A protein, T7/His-tagged

• Cat.No.: REG3A-128H
• Product Overview: Recombinant human REG3a cDNA (27 – 175 aa, derived from BC036776) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&T7
• Form: 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRP SGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCA SLSRSTAFLRWKDYNCNVRLPYVCKFTD
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro human REG3a mediated membrane phospholipids binding for regulating inflammation pathway in anti-bacterial or cancer cell proliferation study with this protein as either coating matrix protein or soluble factor.2. May be used for REG3a protein-protein interaction assay.3. Potential biomarker protein for monitoring cancer growth.4. As antigen for specific antibody production.
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
• Protein length: 27-175 a.a.

Gene Information

• Gene Name: REG3A regenerating islet-derived 3 alpha [ Homo sapiens ]
• Official Symbol: REG3A
• Synonyms: REG3A; regenerating islet-derived 3 alpha; pancreatitis associated protein , PAP; regenerating islet-derived protein 3-alpha; HIP; PAP1; PBCGF; REG III; REG3; REG-3-alpha; reg III-alpha; PAP homologous protein; human proislet peptide; pancreatitis-associated protein 1; proliferation-inducing protein 34; proliferation-inducing protein 42; hepatocarcinoma-intestine-pancreas; pancreatic beta cell growth factor; regenerating islet-derived protein III-alpha; PAP; PAP-H; REG-III; FLJ18565
• Gene ID: 5068
• mRNA Refseq: NM_002580
• Protein Refseq: NP_002571
• MIM: 167805
• UniProt ID: Q06141
• Chromosome Location: 2p12
• Function: binding; sugar binding