Recombinant Human RDBP, His-tagged

• Cat.No.: RDBP-29223TH
• Product Overview: Recombinant fragment, corresponding to amino acids 63-380 of Human NELFe with a N terminal His tag; predicted MWt 37kDa:

Specification

• Description: The protein encoded by this gene is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation. This protein bears similarity to nuclear RNA-binding proteins; however, it has not been demonstrated that this protein binds RNA. The protein contains a tract of alternating basic and acidic residues, largely arginine (R) and aspartic acid (D). The gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6.
• Conjugation: HIS
• Source: E. coli
• Tissue specificity: Widely expressed. Expressed in heart, brain, lung, placenta, liver, skeletal muscle, kidney and pancreas.
• Form: Lyophilised:reconstitution with 111 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: EQAKQLVKSGAISAIKAETKNSGFKRSRTLEGKLKDPEKG PVPTFQPFQRSISADDDLQESSRRPQRKSLYESFVSSS DRLRELGPDGEEAEGPGAGDGPPRSFDWGYEERSGAHS SASPPRSRSRDRSHERNRDRDRDRERDRDRDRDRDRERDR DRDRDRDRDRERDRDRERDRDRDREGPFRRSDSFPERR APRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPP RNCAFVTYEKMESADQAVAELNGTQVESVQLKVNIARK QPMLDAATGKSVWGSLAVQNSPKGCHRDKRTQIVYSDDVY KENLVDGF
• Sequence Similarities: Belongs to the RRM NELF-E family.Contains 1 RRM (RNA recognition motif) domain.
• Protein length: 63-380 a.a.

Gene Information

• Gene Name: RDBP RD RNA binding protein [ Homo sapiens ]
• Official Symbol: RDBP
• Synonyms: RDBP; RD RNA binding protein; negative elongation factor E; D6S45; NELF E; RD; RDP
• Gene ID: 7936
• mRNA Refseq: NM_002904
• Protein Refseq: NP_002895
• MIM: 154040
• Uniprot ID: P18615
• Chromosome Location: 6p21.3
• Pathway: Abortive elongation of HIV-1 transcript in the absence of Tat, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem; Formation of HIV-1 elongation complex in the absence of HIV-1 Tat, organism-specific biosystem; Formation of RNA Pol II elongation complex, organism-specific biosystem
• Function: RNA binding; nucleotide binding