Recombinant Human RBFOX1 protein, GST-tagged
Cat.No. : | RBFOX1-3534H |
Product Overview : | Recombinant Human RBFOX1 protein(1-128 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-128 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MLASQGVLLHPYGVPMIVPAAPYLPGLIQGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPEYTGQTTVPEHTLNLYPPAQTHSEQSPADTSAQTVSGTATQTDDAAPTDGQPQTQPSE |
Gene Name | RBFOX1 RNA binding protein, fox-1 homolog (C. elegans) 1 [ Homo sapiens ] |
Official Symbol | RBFOX1 |
Synonyms | RBFOX1; RNA binding protein, fox-1 homolog (C. elegans) 1; RNA binding protein fox-1 homolog 1; A2BP1; ataxin 2 binding protein 1; FOX 1; hexaribonucleotide binding protein 1; HRNBP1; fox-1 homolog A; ataxin 2-binding protein 1; hexaribonucleotide-binding protein 1; 2BP1; FOX1; FOX-1; |
Gene ID | 54715 |
mRNA Refseq | NM_001142333 |
Protein Refseq | NP_001135805 |
MIM | 605104 |
UniProt ID | Q9NWB1 |
◆ Recombinant Proteins | ||
Adamts5-1756R | Recombinant Rat Adamts5 protein, His & T7-tagged | +Inquiry |
ADAMTS5-534H | Active Recombinant Human ADAMTS5, His-tagged | +Inquiry |
RBFOX1-3534H | Recombinant Human RBFOX1 protein, GST-tagged | +Inquiry |
ADAMTS5-2037M | Recombinant Mouse ADAMTS5 Protein (262-930 aa), His-tagged | +Inquiry |
ADAMTS5-8483Z | Recombinant Zebrafish ADAMTS5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAMTS5-9028HCL | Recombinant Human ADAMTS5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADAMTS5 Products
Required fields are marked with *
My Review for All ADAMTS5 Products
Required fields are marked with *
0
Inquiry Basket