Recombinant Human RARG-LBD Protein, His-tagged

Cat.No. : RARG-1130H
Product Overview : Recombinant Human RARG-LBD Protein (154-415) with a His tag was expressed in E. coli and purified by affinity chromatography in combination with FPLC columns.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 154-415
Description : This gene encodes a retinoic acid receptor that belongs to the nuclear hormone receptor family. Retinoic acid receptors (RARs) act as ligand-dependent transcriptional regulators. When bound to ligands, RARs activate transcription by binding as heterodimers to the retinoic acid response elements (RARE) found in the promoter regions of the target genes. In their unbound form, RARs repress transcription of their target genes. RARs are involved in various biological processes, including limb bud development, skeletal growth, and matrix homeostasis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 29.5 kDa
AA Sequence : MSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREM
Purity : > 95% homogeneous based on SDS-PAGE analysis.
Unit Definition : 1 unit equals 1 nanogram of purified protein. 20-100 units are sufficient for a ligand binding assay and 100 units are sufficient for a protein-protein interaction assay.
Applications : DNA and protein-protein interaction assays.
Storage : Stored at -70 centigrade before use. Avoid repeated freeze thaw cycles.
Storage Buffer : 20 mM Tris-HCl pH 7.9, 100 mM NaCl, 0.2 mM EDTA, 1 mM DTT and 20 % glycerol.
Gene Name RARG retinoic acid receptor gamma [ Homo sapiens (human) ]
Official Symbol RARG
Synonyms RARG; retinoic acid receptor gamma; RARC; NR1B3; retinoic acid receptor gamma; RAR-gamma; nuclear receptor subfamily 1 group B member 3; retinoic acid nuclear receptor gamma variant 1; retinoic acid nuclear receptor gamma variant 2
Gene ID 5916
mRNA Refseq NM_000966
Protein Refseq NP_000957
MIM 180190
UniProt ID P13631

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RARG Products

Required fields are marked with *

My Review for All RARG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon