Recombinant Human RARG-LBD Protein, His-tagged
Cat.No. : | RARG-1130H |
Product Overview : | Recombinant Human RARG-LBD Protein (154-415) with a His tag was expressed in E. coli and purified by affinity chromatography in combination with FPLC columns. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 154-415 |
Description : | This gene encodes a retinoic acid receptor that belongs to the nuclear hormone receptor family. Retinoic acid receptors (RARs) act as ligand-dependent transcriptional regulators. When bound to ligands, RARs activate transcription by binding as heterodimers to the retinoic acid response elements (RARE) found in the promoter regions of the target genes. In their unbound form, RARs repress transcription of their target genes. RARs are involved in various biological processes, including limb bud development, skeletal growth, and matrix homeostasis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 29.5 kDa |
AA Sequence : | MSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREM |
Purity : | > 95% homogeneous based on SDS-PAGE analysis. |
Unit Definition : | 1 unit equals 1 nanogram of purified protein. 20-100 units are sufficient for a ligand binding assay and 100 units are sufficient for a protein-protein interaction assay. |
Applications : | DNA and protein-protein interaction assays. |
Storage : | Stored at -70 centigrade before use. Avoid repeated freeze thaw cycles. |
Storage Buffer : | 20 mM Tris-HCl pH 7.9, 100 mM NaCl, 0.2 mM EDTA, 1 mM DTT and 20 % glycerol. |
Gene Name | RARG retinoic acid receptor gamma [ Homo sapiens (human) ] |
Official Symbol | RARG |
Synonyms | RARG; retinoic acid receptor gamma; RARC; NR1B3; retinoic acid receptor gamma; RAR-gamma; nuclear receptor subfamily 1 group B member 3; retinoic acid nuclear receptor gamma variant 1; retinoic acid nuclear receptor gamma variant 2 |
Gene ID | 5916 |
mRNA Refseq | NM_000966 |
Protein Refseq | NP_000957 |
MIM | 180190 |
UniProt ID | P13631 |
◆ Recombinant Proteins | ||
Rarg-5381M | Recombinant Mouse Rarg Protein, Myc/DDK-tagged | +Inquiry |
RARG-31057TH | Recombinant Human RARG | +Inquiry |
RARG-2512H | Active Recombinant Human Retinoic Acid Receptor, Gamma, His-tagged | +Inquiry |
RARG-1138H | Recombinant Human RARG, Ligand Binding Domain, GST-tagged | +Inquiry |
RARG-7425M | Recombinant Mouse RARG Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RARG-2512HCL | Recombinant Human RARG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RARG Products
Required fields are marked with *
My Review for All RARG Products
Required fields are marked with *
0
Inquiry Basket