Recombinant Human RAPGEF3 protein, His-tagged

• Cat.No.: RAPGEF3-3056H
• Product Overview: Recombinant Human RAPGEF3 protein(43-203 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 43-203 aa
• AA Sequence: MVLRRMHRPRSCSYQLLLEHQRPSCIQGLRWTPLTNSEESLDFSESLEQASTERVLRAGRQLHRHLLATCPNLIRDRKYHLRLYRQCCSGRELVDGILALGLGVHSRSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVGTHEMEEELAE
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: RAPGEF3 Rap guanine nucleotide exchange factor (GEF) 3 [ Homo sapiens ]
• Official Symbol: RAPGEF3
• Synonyms: RAPGEF3; Rap guanine nucleotide exchange factor (GEF) 3; RAP guanine nucleotide exchange factor (GEF) 3; rap guanine nucleotide exchange factor 3; bcm910; cAMP GEFI; EPAC; exchange protein directly activated by cAMP 1; EPAC 1; 9330170P05Rik; exchange factor directly activated by cAMP 1; cAMP-regulated guanine nucleotide exchange factor I; Rap1 guanine-nucleotide-exchange factor directly activated by cAMP; EPAC1; HSU79275; CAMP-GEFI; MGC21410
• Gene ID: 10411
• mRNA Refseq: NM_001098531
• Protein Refseq: NP_001092001
• MIM: 606057
• UniProt ID: O95398