Recombinant Human RAPGEF3 protein, His-tagged
Cat.No. : | RAPGEF3-3056H |
Product Overview : | Recombinant Human RAPGEF3 protein(43-203 aa), fused to His tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 43-203 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MVLRRMHRPRSCSYQLLLEHQRPSCIQGLRWTPLTNSEESLDFSESLEQASTERVLRAGRQLHRHLLATCPNLIRDRKYHLRLYRQCCSGRELVDGILALGLGVHSRSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVGTHEMEEELAE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RAPGEF3 Rap guanine nucleotide exchange factor (GEF) 3 [ Homo sapiens ] |
Official Symbol | RAPGEF3 |
Synonyms | RAPGEF3; Rap guanine nucleotide exchange factor (GEF) 3; RAP guanine nucleotide exchange factor (GEF) 3; rap guanine nucleotide exchange factor 3; bcm910; cAMP GEFI; EPAC; exchange protein directly activated by cAMP 1; EPAC 1; 9330170P05Rik; exchange factor directly activated by cAMP 1; cAMP-regulated guanine nucleotide exchange factor I; Rap1 guanine-nucleotide-exchange factor directly activated by cAMP; EPAC1; HSU79275; CAMP-GEFI; MGC21410; |
Gene ID | 10411 |
mRNA Refseq | NM_001098531 |
Protein Refseq | NP_001092001 |
MIM | 606057 |
UniProt ID | O95398 |
◆ Recombinant Proteins | ||
RAPGEF3-1032H | Recombinant Human Rap guanine nucleotide exchange factor (GEF) 3 | +Inquiry |
RAPGEF3-3056H | Recombinant Human RAPGEF3 protein, His-tagged | +Inquiry |
RAPGEF3-4927R | Recombinant Rat RAPGEF3 Protein | +Inquiry |
RAPGEF3-3474H | Recombinant Human RAPGEF3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RAPGEF3-2181H | Recombinant Human RAPGEF3, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAPGEF3-2521HCL | Recombinant Human RAPGEF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAPGEF3 Products
Required fields are marked with *
My Review for All RAPGEF3 Products
Required fields are marked with *
0
Inquiry Basket