Recombinant Human RAP1B protein, His-tagged
Cat.No. : | RAP1B-2828H |
Product Overview : | Recombinant Human RAP1B protein(1-184 aa), fused to His tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-184 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RAP1B RAP1B, member of RAS oncogene family [ Homo sapiens ] |
Official Symbol | RAP1B |
Synonyms | RAP1B; RAP1B, member of RAS oncogene family; ras-related protein Rap-1b; DKFZp586H0723; K REV; RAL1B; RAS-related protein RAP1B; small GTP binding protein; GTP-binding protein smg p21B; Ras family small GTP binding protein RAP1B; K-REV; FLJ18601; |
Gene ID | 5908 |
mRNA Refseq | NM_001010942 |
Protein Refseq | NP_001010942 |
MIM | 179530 |
UniProt ID | P61224 |
◆ Recombinant Proteins | ||
RAP1B-587C | Recombinant Cynomolgus Monkey RAP1B Protein, His (Fc)-Avi-tagged | +Inquiry |
RAP1B-4583R | Recombinant Rat RAP1B Protein, His (Fc)-Avi-tagged | +Inquiry |
RAP1B-9939Z | Recombinant Zebrafish RAP1B | +Inquiry |
RAP1B-3979H | Recombinant Human RAP1B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RAP1B-2828H | Recombinant Human RAP1B protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAP1B-2528HCL | Recombinant Human RAP1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAP1B Products
Required fields are marked with *
My Review for All RAP1B Products
Required fields are marked with *
0
Inquiry Basket