Recombinant Human RALA protein, GST-tagged

• Cat.No.: RALA-301581H
• Product Overview: Recombinant Human RALA (1-206 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Met1-Leu206
• AA Sequence: MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: RALA v-ral simian leukemia viral oncogene homolog A (ras related) [ Homo sapiens ]
• Official Symbol: RALA
• Synonyms: RALA; v-ral simian leukemia viral oncogene homolog A (ras related); RAL; ras-related protein Ral-A; Ras family small GTP binding protein RALA; RAS like protein A; Ras related protein Ral A; RAS-like protein A; MGC48949
• Gene ID: 5898
• mRNA Refseq: NM_005402
• Protein Refseq: NP_005393
• MIM: 179550
• UniProt ID: P11233