Recombinant Human RAI1, GST-tagged

• Cat.No.: RAI1-49H
• Product Overview: Recombinant Human RAI1(1 a.a. - 101 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is located within the Smith-Magenis syndrome region on chromosome 17. It is highly similar to its mouse counterpart and is expressed at high levels mainly in neuronal tissues. The protein encoded by this gene includes a polymorphic polyglutamine tract in the N-terminal domain. Expression of the mouse counterpart in neurons is induced by retinoic acid. This gene is associated with both the severity of the phenotype and the response to medication in schizophrenic patients.
• Molecular Mass: 36.85 kDa
• AA Sequence: MQSFRERCGFHGKQQNYQQTSQETSRLENYRQPSQAGLSCDRQRLLAKDYYNPQPYPSYEGGAGTPSGTAAAVAA DKYHRGSKALPTQQGLQGRPAFPGYG
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RAI1 retinoic acid induced 1 [ Homo sapiens ]
• Official Symbol: RAI1
• Synonyms: RAI1; retinoic acid induced 1; SMCR, Smith Magenis syndrome chromosome region; retinoic acid-induced protein 1; DKFZP434A139; KIAA1820; MGC12824; SMS; Smith-Magenis syndrome chromosome region; SMCR
• Gene ID: 10743
• mRNA Refseq: NM_030665
• Protein Refseq: NP_109590
• MIM: 607642
• UniProt ID: Q7Z5J4
• Chromosome Location: 17p11.2
• Function: enhancer binding; zinc ion binding