Name: Recombinant Human RAI1, GST-tagged
SKU: RAI1-49H

Species :	Human
Source :	Wheat Germ
Tag :	GST
Description :	This gene is located within the Smith-Magenis syndrome region on chromosome 17. It is highly similar to its mouse counterpart and is expressed at high levels mainly in neuronal tissues. The protein encoded by this gene includes a polymorphic polyglutamine tract in the N-terminal domain. Expression of the mouse counterpart in neurons is induced by retinoic acid. This gene is associated with both the severity of the phenotype and the response to medication in schizophrenic patients.
Molecular Mass :	36.85 kDa
AA Sequence :	MQSFRERCGFHGKQQNYQQTSQETSRLENYRQPSQAGLSCDRQRLLAKDYYNPQPYPSYEGGAGTPSGTAAAVAA DKYHRGSKALPTQQGLQGRPAFPGYG
Applications :	ELISA; WB-Re; AP; Array
Storage :	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	RAI1 retinoic acid induced 1 [ Homo sapiens ]
Official Symbol	RAI1
Synonyms	RAI1; retinoic acid induced 1; SMCR, Smith Magenis syndrome chromosome region; retinoic acid-induced protein 1; DKFZP434A139; KIAA1820; MGC12824; SMS; Smith-Magenis syndrome chromosome region; SMCR
Gene ID	10743
mRNA Refseq	NM_030665
Protein Refseq	NP_109590
MIM	607642
UniProt ID	Q7Z5J4
Chromosome Location	17p11.2
Function	enhancer binding; zinc ion binding;