Recombinant Human RAG2
Cat.No. : | RAG2-29371TH |
Product Overview : | Recombinant full length Human RAG2 with N terminal proprietary tag; Predicted MWt 84.04 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
ProteinLength : | 527 amino acids |
Description : | This gene encodes a protein that is involved in the initiation of V(D)J recombination during B and T cell development. This protein forms a complex with the product of the adjacent recombination activating gene 1, and this complex can form double-strand breaks by cleaving DNA at conserved recombination signal sequences. The recombination activating gene 1 component is thought to contain most of the catalytic activity, while the N-terminal of the recombination activating gene 2 component is thought to form a six-bladed propeller in the active core that serves as a binding scaffold for the tight association of the complex with DNA. A C-terminal plant homeodomain finger-like motif in this protein is necessary for interactions with chromatin components, specifically with histone H3 that is trimethylated at lysine 4. Mutations in this gene cause Omenn syndrome, a form of severe combined immunodeficiency associated with autoimmune-like symptoms. |
Molecular Weight : | 84.040kDa inclusive of tags |
Tissue specificity : | Cells of the B- and T-lymphocyte lineages. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSLQMVTVSNNIALIQPGFSLMNFDGQVFFFGQKGWPKRS CPTGVFHLDVKHNHVKLKPTIFSKDSCYLPPLRYPATCTF KGSLESEKHQYIIHGGKTPNNEVSDKIYVMSIVCKNNKKV TFRCTEKDLVGDVPEARYGHSINVVYSRGKSMGALFGGRS YMPSTHRTTEKWNSVADCLPCVFLVDFEFGCATSYILPEL QDGLSFHVSIAKNDTIYILGGHSLANNIRPANLYRIRVDL PLGSPAVNCTVLPGGISVSSAILTQTNNDEFVIVGGYQLE NQKRMICNIISLEDNKIEIREMETPDWTPDIKHSKIWFGS NTGNGTVFLGIPGDNKQVVSEGFYFYMLKCAEDDTNEEQT TFTNSQTSTEDPGDSTPFEDSEEFCFSAEANSFDGDDEFD TYNEDDEEDESETGYWITCCPTCDVDINTWVPFYSTELNK PAMIYCSHGDGHWVHAQCMDLAERTLIHLSAGSNKYYCNE HVEIARALHTPQRVLPLKKPPMKSLRKKGSGKILTPAKKS FLRRLFD |
Sequence Similarities : | Belongs to the RAG2 family.Contains 1 PHD-type zinc finger. |
Gene Name | RAG2 recombination activating gene 2 [ Homo sapiens ] |
Official Symbol | RAG2 |
Synonyms | RAG2; recombination activating gene 2; V(D)J recombination-activating protein 2; |
Gene ID | 5897 |
mRNA Refseq | NM_000536 |
Protein Refseq | NP_000527 |
MIM | 179616 |
Uniprot ID | P55895 |
Chromosome Location | 11p13 |
Pathway | C-MYB transcription factor network, organism-specific biosystem; Primary immunodeficiency, organism-specific biosystem; Primary immunodeficiency, conserved biosystem; |
Function | DNA binding; chromatin binding; endonuclease activity; metal ion binding; methylated histone residue binding; |
◆ Recombinant Proteins | ||
XPNPEP3-414H | Recombinant Human XPNPEP3 Protein, His-tagged | +Inquiry |
SFMBT1-5353R | Recombinant Rat SFMBT1 Protein | +Inquiry |
DCK-06HFL | Active Recombinant Full Length Human deoxycytidine kinase Protein, His tagged | +Inquiry |
Cyclopentanone monooxygenase-1575R | Recombinant Rhodococcus sp. S2-17 Cyclopentanone monooxygenase Protein (M1-A539) | +Inquiry |
FARP1-4537C | Recombinant Chicken FARP1 | +Inquiry |
◆ Native Proteins | ||
Lectin-1759C | Active Native Canavalia ensiformis Concanavalin A Protein, Fluorescein Labeled | +Inquiry |
IgG-333T | Native Turkey IgG | +Inquiry |
GPOSP-40 | Active Native Glycerol-3-phosphate oxidase | +Inquiry |
Thyroid-018H | Human Thyroid Lysate, Total Protein | +Inquiry |
S100A9-3179H | Native Human S100A9 protein(Met1-Pro114) | +Inquiry |
◆ Cell & Tissue Lysates | ||
LTBR-1052RCL | Recombinant Rat LTBR cell lysate | +Inquiry |
AGFG1-8982HCL | Recombinant Human AGFG1 293 Cell Lysate | +Inquiry |
PACRG-3475HCL | Recombinant Human PACRG 293 Cell Lysate | +Inquiry |
GAGE8-6048HCL | Recombinant Human GAGE8 293 Cell Lysate | +Inquiry |
RPL35-2201HCL | Recombinant Human RPL35 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAG2 Products
Required fields are marked with *
My Review for All RAG2 Products
Required fields are marked with *
0
Inquiry Basket