Recombinant Human RAD51D protein, GST-tagged

• Cat.No.: RAD51D-2156H
• Product Overview: Recombinant Human RAD51D protein(1-253 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: GST
• Protein Length: 1-253 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKALVALRRVLLAQFSAFPVNGADLYEELKTSTAILSTGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCMAANVAHGLQQNVLYVDSNGGLTASRLLQLLQAKTQDEEEQAEALRRIQVVHAFDIFQMLDVLQELRGTVAQQVTGSSGTVKVVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGMAVVVTNHITR
• Purity: 85%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: RAD51D RAD51 homolog D (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: RAD51D
• Synonyms: RAD51D; RAD51 homolog D (S. cerevisiae); RAD51 (S. cerevisiae) like 3 , RAD51 like 3 (S. cerevisiae) , RAD51L3; DNA repair protein RAD51 homolog 4; HsTRAD; R51H3; recombination repair protein; Trad; RAD51-like protein 3; TRAD; BROVCA4; RAD51L3
• mRNA Refseq: NM_001142571
• Protein Refseq: NP_001136043
• MIM: 602954
• UniProt ID: O75771
• Gene ID: 5892