Recombinant Human RAD17 Protein, His-tagged

• Cat.No.: RAD17-2153H
• Product Overview: Recombinant Human RAD17(431-681aa) fused with His tag was produced in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 431-681aa
• Description: The protein encoded by this gene is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. This protein binds to chromatin prior to DNA damage and is phosphorylated by the checkpoint kinase ATR following damage. This protein recruits the RAD1-RAD9-HUS1 checkpoint protein complex onto chromatin after DNA damage, which may be required for its phosphorylation. The phosphorylation of this protein is required for the DNA-damage-induced cell cycle G2 arrest, and is thought to be a critical early event during checkpoint signaling in DNA-damaged cells. Multiple alternatively spliced transcript variants of this gene, which encode four distinct protein isoforms, have been reported. Two pseudogenes, located on chromosomes 7 and 13, have been identified.
• Form: The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7. ) added with 300mM Imidazole and 15% glycerol.
• AA sequence: SHMPGDLFNLYLHQNYIDFFMEIDDIVRASEFLSFADILSGDWNTRSLLREYSTSIATRGVMHSNKARGYAHCQGGGSSFRPLHKPQWFLINKKYRENCLAAKALFPDFCLPALCRQTQLLPYLALLTIPMRNQAQISFIQDIGRLPLKRHFGRLKMEALTDREHGMIDPDSGDEAQLNGGHSAEESLGEPTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIEDYESDGT
• Storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
• Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.

Gene Information

• Gene Name: RAD17 RAD17 homolog (S. pombe) [ Homo sapiens ]
• Official Symbol: RAD17
• Synonyms: RAD17; RAD17 homolog (S. pombe); RAD1 (S. pombe) homolog; cell cycle checkpoint protein RAD17; CCYC; RAD17Sp; Rad24; RAD1 homolog; Rad17-like protein; RF-C activator 1 homolog; RF-C/activator 1 homolog; cell cycle checkpoint protein (RAD17); R24L; RAD24; HRAD17; RAD17SP; FLJ41520
• Gene ID: 5884
• mRNA Refseq: NM_002873
• Protein Refseq: NP_002864
• MIM: 603139
• UniProt ID: O75943