Recombinant Human RABGGTB protein, His-tagged
Cat.No. : | RABGGTB-3232H |
Product Overview : | Recombinant Human RABGGTB protein(1-331 aa), fused to His tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-331 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MGTPQKDVIIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGIYWGLTVMDLMGQLHRMNREEILAFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSINVIDVNKVVEYVKGLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRNFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVNPVFCMPEEVLQRVNVQPELVS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RABGGTB Rab geranylgeranyltransferase, beta subunit [ Homo sapiens ] |
Official Symbol | RABGGTB |
Synonyms | RABGGTB; Rab geranylgeranyltransferase, beta subunit; geranylgeranyl transferase type-2 subunit beta; GGTase-II-beta; rab GGTase beta; rab GG transferase beta; rab geranylgeranyltransferase subunit beta; rab geranyl-geranyltransferase subunit beta; geranylgeranyl transferase type II subunit beta; type II protein geranyl-geranyltransferase subunit beta; GGTB; |
Gene ID | 5876 |
mRNA Refseq | NM_004582 |
Protein Refseq | NP_004573 |
MIM | 179080 |
UniProt ID | P53611 |
◆ Recombinant Proteins | ||
RABGGTB-3232H | Recombinant Human RABGGTB protein, His-tagged | +Inquiry |
RABGGTB-4906R | Recombinant Rat RABGGTB Protein | +Inquiry |
RABGGTB-301145H | Recombinant Human RABGGTB protein, GST-tagged | +Inquiry |
Rabggtb-5471R | Recombinant Rat Rab Geranylgeranyltransferase, Beta Subunit | +Inquiry |
RABGGTB-12335Z | Recombinant Zebrafish RABGGTB | +Inquiry |
◆ Cell & Tissue Lysates | ||
RABGGTB-2572HCL | Recombinant Human RABGGTB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RABGGTB Products
Required fields are marked with *
My Review for All RABGGTB Products
Required fields are marked with *
0
Inquiry Basket