Recombinant Human RAB5C Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | RAB5C-054H |
Product Overview : | RAB5C MS Standard C13 and N15-labeled recombinant protein (NP_958842) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Members of the Rab protein family are small GTPases of the Ras superfamily that are thought to ensure fidelity in the process of docking and/or fusion of vesicles with their correct acceptor compartment. |
Molecular Mass : | 23.3 kDa |
AA Sequence : | MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RAB5C RAB5C, member RAS oncogene family [ Homo sapiens (human) ] |
Official Symbol | RAB5C |
Synonyms | RAB5C; RAB5C, member RAS oncogene family; L1880; RAB5CL; RAB5L; RABL; ras-related protein Rab-5C; RAB5C, member of RAS oncogene family |
Gene ID | 5878 |
mRNA Refseq | NM_201434 |
Protein Refseq | NP_958842 |
MIM | 604037 |
UniProt ID | P51148 |
◆ Recombinant Proteins | ||
RAB5C-7361M | Recombinant Mouse RAB5C Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB5C-6094C | Recombinant Chicken RAB5C | +Inquiry |
RAB5C-054H | Recombinant Human RAB5C Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
RAB5C-714HFL | Active Recombinant Full Length Human RAB5C Protein, C-Flag-tagged | +Inquiry |
RAB5C-13835M | Recombinant Mouse RAB5C Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB5C-524HCL | Recombinant Human RAB5C lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAB5C Products
Required fields are marked with *
My Review for All RAB5C Products
Required fields are marked with *
0
Inquiry Basket