Recombinant Human RAB5C Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: RAB5C-054H
• Product Overview: RAB5C MS Standard C13 and N15-labeled recombinant protein (NP_958842) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Members of the Rab protein family are small GTPases of the Ras superfamily that are thought to ensure fidelity in the process of docking and/or fusion of vesicles with their correct acceptor compartment.
• Molecular Mass: 23.3 kDa
• AA Sequence: MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RAB5C RAB5C, member RAS oncogene family [ Homo sapiens (human) ]
• Official Symbol: RAB5C
• Synonyms: RAB5C; RAB5C, member RAS oncogene family; L1880; RAB5CL; RAB5L; RABL; ras-related protein Rab-5C; RAB5C, member of RAS oncogene family
• Gene ID: 5878
• mRNA Refseq: NM_201434
• Protein Refseq: NP_958842
• MIM: 604037
• UniProt ID: P51148