Active Recombinant Full Length Human RAB5C Protein, C-Flag-tagged

• Cat.No.: RAB5C-714HFL
• Product Overview: Recombinant Full Length Human RAB5C Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: Members of the Rab protein family are small GTPases of the Ras superfamily that are thought to ensure fidelity in the process of docking and/or fusion of vesicles with their correct acceptor compartment.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Bio-activity: Enzyme activity
• Molecular Mass: 23.3 kDa
• AA Sequence: MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTV KFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLAS KRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASR
  SQCCSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome
• Protein Pathways: Endocytosis
• Full Length: Full L.

Gene Information

• Gene Name: RAB5C RAB5C, member RAS oncogene family [ Homo sapiens (human) ]
• Official Symbol: RAB5C
• Synonyms: RABL; L1880; RAB5L; RAB5CL
• Gene ID: 5878
• mRNA Refseq: NM_201434.3
• Protein Refseq: NP_958842.1
• MIM: 604037
• UniProt ID: P51148