Recombinant Human RAB4A protein, T7-tagged

• Cat.No.: RAB4A-208H
• Product Overview: Recombinant human RAB4A ( 218 aa, Isoform-I ) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 218 a.a.
• Form: 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGEFGSTSMSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIIN VGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLD ADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPR RAQAPNAQECGC
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: RAB4A RAB4A, member RAS oncogene family [ Homo sapiens ]
• Official Symbol: RAB4A
• Synonyms: RAB4A; RAB4A, member RAS oncogene family; RAB4; ras-related protein Rab-4A; HRES 1/RAB4; Oncogene RAB4; RAB4, member RAS oncogene family; HRES-1/RAB4
• Gene ID: 5867
• mRNA Refseq: NM_004578
• Protein Refseq: NP_004569
• MIM: 179511
• UniProt ID: P20338
• Chromosome Location: 1q42-q43
• Pathway: Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Insulin Signaling, organism-specific biosystem; Signaling events mediated by TCPTP, organism-specific biosystem
• Function: ATPase activator activity; ATPase binding; GDP binding; GTP binding; GTPase activity; ionotropic glutamate receptor binding; nucleotide binding; protein binding; protein transporter activity; syntaxin binding