Recombinant Human RAB4A protein, T7-tagged

Source :	E. coli
Species :	Human
Tag :	T7
Form :	0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence :	MASMTGGQQMGRGEFGSTSMSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIIN VGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLD ADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPR RAQAPNAQECGC
Purity :	>90% by SDS-PAGE
Storage :	Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Protein length :	218 a.a.

Gene Name	RAB4A RAB4A, member RAS oncogene family [ Homo sapiens ]
Official Symbol	RAB4A
Synonyms	RAB4A; RAB4A, member RAS oncogene family; RAB4; ras-related protein Rab-4A; HRES 1/RAB4; Oncogene RAB4; RAB4, member RAS oncogene family; HRES-1/RAB4;
Gene ID	5867
mRNA Refseq	NM_004578
Protein Refseq	NP_004569
MIM	179511
UniProt ID	P20338
Chromosome Location	1q42-q43
Pathway	Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Insulin Signaling, organism-specific biosystem; Signaling events mediated by TCPTP, organism-specific biosystem;
Function	ATPase activator activity; ATPase binding; GDP binding; GTP binding; GTPase activity; ionotropic glutamate receptor binding; nucleotide binding; protein binding; protein transporter activity; syntaxin binding;