Recombinant Human RAB43 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RAB43-2541H
• Product Overview: RAB43 MS Standard C13 and N15-labeled recombinant protein (NP_940892) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. The low intrinsic GTPase activity of RAB43 is activated by USP6NL. Involved in retrograde transport from the endocytic pathway to the Golgi apparatus. Involved in the transport of Shiga toxin from early and recycling endosomes to the trans-Golgi network. Required for the structural integrity of the Golgi complex. Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 23.3 kDa
• AA Sequence: MAGPGPGPGDPDEQYDFLFKLVLVGDASVGKTCVVQRFKTGAFSERQGSTIGVDFTMKTLEIQGKRVKLQIWDTAGQERFRTITQSYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGCGCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RAB43 RAB43, member RAS oncogene family [ Homo sapiens (human) ]
• Official Symbol: RAB43
• Synonyms: RAB43; RAB43, member RAS oncogene family; ras-related protein Rab-43; ISY1; RAB11B; RAB41; ras-related protein Rab-41; MGC90481
• Gene ID: 339122
• mRNA Refseq: NM_198490
• Protein Refseq: NP_940892
• UniProt ID: Q86YS6