Recombinant Human QSOX1 protein(101-175aa), His-GST&Myc-tagged

• Cat.No.: QSOX1-255H
• Product Overview: Recombinant Human QSOX1 protein(O00391)(101-175aa), fused with N-terminal His and GST tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST&His&Myc
• Protein Length: 101-175aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 43.4 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: CAEETNSAVCRDFNIPGFPTVRFFKAFTKNGSGAVFPVAGADVQTLRERLIDALESHHDTWPPACPPLEPAKLEE

Gene Information

• Gene Name: QSOX1 quiescin Q6 sulfhydryl oxidase 1 [ Homo sapiens ]
• Official Symbol: QSOX1
• Synonyms: QSOX1; quiescin Q6 sulfhydryl oxidase 1; QSCN6, quiescin Q6; sulfhydryl oxidase 1; hQSOX; Q6; QSCN6; FLJ34858
• Gene ID: 5768
• mRNA Refseq: NM_001004128
• Protein Refseq: NP_001004128
• MIM: 603120
• UniProt ID: O00391