Recombinant Human QKI Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: QKI-5587H
• Product Overview: QKI MS Standard C13 and N15-labeled recombinant protein (NP_996736) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is an RNA-binding protein that regulates pre-mRNA splicing, export of mRNAs from the nucleus, protein translation, and mRNA stability. The encoded protein is involved in myelinization and oligodendrocyte differentiation and may play a role in schizophrenia. Multiple transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 35.8 kDa
• AA Sequence: MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLEWIEMPVMPDISAHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: QKI QKI, KH domain containing RNA binding [ Homo sapiens (human) ]
• Official Symbol: QKI
• Synonyms: QKI; QKI, KH domain containing, RNA binding; quaking homolog, KH domain RNA binding (mouse); protein quaking; QK3; RNA binding protein HQK; quaking homolog, KH domain RNA binding; homolog of mouse quaking QKI (KH domain RNA binding protein); QK; Hqk; QK1; hqkI; DKFZp586I0923
• Gene ID: 9444
• mRNA Refseq: NM_206854
• Protein Refseq: NP_996736
• MIM: 609590
• UniProt ID: Q96PU8