Recombinant Human PYY protein, His-tagged

Cat.No. : PYY-3398H
Product Overview : Recombinant Human PYY protein(P10082)(31-64aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 31-64aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 8.1 kDa
AA Sequence : IKPEAPREDASPEELNRYYASLRHYLNLVTRQRY
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name PYY peptide YY [ Homo sapiens ]
Official Symbol PYY
Synonyms PYY; peptide YY; PYY1; PYY-I; peptide tyrosine tyrosine;
Gene ID 5697
mRNA Refseq NM_004160
Protein Refseq NP_004151
UniProt ID P10082

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PYY Products

Required fields are marked with *

My Review for All PYY Products

Required fields are marked with *

0

Inquiry Basket

cartIcon