Recombinant Full Length Human PYY Protein, GST tagged

• Cat.No.: PYY-29935TH
• Product Overview: Recombinant full length Human Peptide YY with N terminal proprietary tag; Predicted MWt 36.74 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 1-97 a.a.
• Description: The protein encoded by this gene is proteolytically processed to release a peptide that inhibits pancreatic secretion and mobility in the gut. Rare variations in this gene could increase susceptibility to obesity.
• Molecular Weight: 36.740kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW
• Sequence Similarities: Belongs to the NPY family.

Gene Information

• Gene Name: PYY peptide YY [ Homo sapiens ]
• Official Symbol: PYY
• Synonyms: PYY; peptide YY; PYY1
• Gene ID: 5697
• mRNA Refseq: NM_004160
• Protein Refseq: NP_004151
• Uniprot ID: P10082
• Chromosome Location: 17q21.1
• Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Peptide ligand-binding receptors, organism-specific biosystem
• Function: hormone activity; neuropeptide hormone activity