Recombinant Human PYY protein, GST-tagged
Cat.No. : | PYY-371H |
Product Overview : | Recombinant Human PYY protein(NP_004151)(29-97 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 29-97 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). |
Gene Name | PYY peptide YY [ Homo sapiens ] |
Official Symbol | PYY |
Synonyms | PYY; peptide YY; PYY1; PYY-I; peptide tyrosine tyrosine; |
Gene ID | 5697 |
mRNA Refseq | NM_004160 |
Protein Refseq | NP_004151 |
UniProt ID | P10082 |
◆ Recombinant Proteins | ||
PYY-370H | Recombinant Human PYY Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Pyy-5276M | Recombinant Full Length Mouse Pyy Protein, Myc/DDK-tagged | +Inquiry |
Pyy-1457R | Recombinant Rat Pyy protein, His & T7-tagged | +Inquiry |
PYY-4521R | Recombinant Rat PYY Protein, His (Fc)-Avi-tagged | +Inquiry |
PYY-2088H | Recombinant Human PYY, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PYY-2641HCL | Recombinant Human PYY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PYY Products
Required fields are marked with *
My Review for All PYY Products
Required fields are marked with *
0
Inquiry Basket