Recombinant Mouse Pyy protein, GST-tagged
Cat.No. : | Pyy-4564M |
Product Overview : | Recombinant Mouse Pyy protein(Q9EPS2)(29-64aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | GST |
Protein Length : | 29-64aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.2 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY |
Gene Name | Pyy peptide YY [ Mus musculus ] |
Official Symbol | Pyy |
Synonyms | PYY; peptide YY; MGC19143; |
Gene ID | 103966 |
◆ Recombinant Proteins | ||
Pyy-5276M | Recombinant Full Length Mouse Pyy Protein, Myc/DDK-tagged | +Inquiry |
PYY-370H | Recombinant Human PYY Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
PYY-3397H | Recombinant Human PYY protein, GST-tagged | +Inquiry |
PYY-4521R | Recombinant Rat PYY Protein, His (Fc)-Avi-tagged | +Inquiry |
PYY-4811M | Recombinant Mouse PYY Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PYY-2641HCL | Recombinant Human PYY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Pyy Products
Required fields are marked with *
My Review for All Pyy Products
Required fields are marked with *
0
Inquiry Basket