Recombinant Human PUM1 protein, His-tagged
Cat.No. : | PUM1-6895H |
Product Overview : | Recombinant Human PUM1 protein(1-128 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-128 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHGEQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDEL |
Gene Name | PUM1 pumilio homolog 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | PUM1 |
Synonyms | PUM1; pumilio homolog 1 (Drosophila); pumilio (Drosophila) homolog 1; pumilio homolog 1; KIAA0099; PUMH1; pumilio-1; PUMH; HSPUM; PUML1; |
Gene ID | 9698 |
mRNA Refseq | NM_001020658 |
Protein Refseq | NP_001018494 |
MIM | 607204 |
UniProt ID | Q14671 |
◆ Recombinant Proteins | ||
Pum1-5257M | Recombinant Mouse Pum1 Protein, Myc/DDK-tagged | +Inquiry |
PUM1-6896H | Recombinant Human PUM1 protein, GST-tagged | +Inquiry |
PUM1-2069H | Recombinant Human PUM1 protein, His-tagged | +Inquiry |
PUM1-31264TH | Recombinant Human PUM1, His-tagged | +Inquiry |
PUM1-6895H | Recombinant Human PUM1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PUM1-1445HCL | Recombinant Human PUM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PUM1 Products
Required fields are marked with *
My Review for All PUM1 Products
Required fields are marked with *
0
Inquiry Basket