Recombinant Human PUM1, His-tagged

• Cat.No.: PUM1-31264TH
• Product Overview: Recombinant fragment, corresponding to amino acids 1005-1186 of Human Pumilio 1 with N terminal His tag; 182 amino acids, 25kDa.

Specification

• Description: This gene encodes a member of the PUF family, evolutionarily conserved RNA-binding proteins related to the Pumilio proteins of Drosophila and the fem-3 mRNA binding factor proteins of C. elegans. The encoded protein contains a sequence-specific RNA binding domain comprised of eight repeats and N- and C-terminal flanking regions, and serves as a translational regulator of specific mRNAs by binding to their 3 untranslated regions. The evolutionarily conserved function of the encoded protein in invertebrates and lower vertebrates suggests that the human protein may be involved in translational regulation of embryogenesis, and cell development and differentiation. Alternatively spliced transcript variants encoding different isoforms have been described.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 89 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Store at 4°C. Upon reconstitution store at -80oC.
• Sequences of amino acids: YGCRVIQRILEHCLPDQTLPILEELHQHTEQLVQDQYGNY VIQHVLEHGRPEDKSKIVAEIRGNVLVLSQHKFASNVV EKCVTHASRTERAVLIDEVCTMNDGPHSALYTMMKDQYANYVVQKMIDVAEPGQRKIVMHKIRPHIATLRKYTYGKHI LAKLEKYYMKNGVDLGPICGPPNGII
• Protein length: 1005-1186 a.a.

Gene Information

• Gene Name: PUM1 pumilio homolog 1 (Drosophila) [ Homo sapiens ]
• Official Symbol: PUM1
• Synonyms: PUM1; pumilio homolog 1 (Drosophila); pumilio (Drosophila) homolog 1; pumilio homolog 1; KIAA0099; PUMH1
• Gene ID: 9698
• mRNA Refseq: NM_001020658
• Protein Refseq: NP_001018494
• MIM: 607204
• Uniprot ID: Q14671
• Chromosome Location: 1p35.2
• Pathway: Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; trans-Golgi Network Vesicle Budding, organism-specific biosystem
• Function: RNA binding; binding