Recombinant Human PTRH2 Protein, GST-tagged

• Cat.No.: PTRH2-235H
• Product Overview: Human Bit1 full-length ORF ( AAH06807, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 45.43 kDa
• AA Sequence: MPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PTRH2 peptidyl-tRNA hydrolase 2 [ Homo sapiens ]
• Official Symbol: PTRH2
• Synonyms: PTRH2; peptidyl-tRNA hydrolase 2; peptidyl-tRNA hydrolase 2, mitochondrial; Bcl 2 inhibitor of transcription; BIT1; CGI 147; PTH2; PTH 2; bcl-2 inhibitor of transcription 1; CGI-147; FLJ32471
• Gene ID: 51651
• mRNA Refseq: NM_016077
• Protein Refseq: NP_057161
• MIM: 608625
• UniProt ID: Q9Y3E5