Recombinant Human PTRH2, His-tagged

• Cat.No.: PTRH2-31259TH
• Product Overview: Recombinant full lenght Human PTRH2 with an N terminal His tag; 137aa, 14.9kDa inclusive of tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 116 amino acids
• Description: PTRH2 (peptidyl-tRNA hydrolase 2), also known as BIT1, is a mitochondrial protein. During apoptosis, PTRH2 is released from the mitochondria to the cytoplasm.
• Conjugation: HIS
• Molecular Weight: 14.900kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: 0% NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY
• Sequence Similarities: Belongs to the PTH2 family.

Gene Information

• Gene Name: PTRH2 peptidyl-tRNA hydrolase 2 [ Homo sapiens ]
• Official Symbol: PTRH2
• Synonyms: PTRH2; peptidyl-tRNA hydrolase 2; peptidyl-tRNA hydrolase 2, mitochondrial; Bcl 2 inhibitor of transcription; BIT1; CGI 147; PTH2
• Gene ID: 51651
• mRNA Refseq: NM_016077
• Protein Refseq: NP_057161
• MIM: 608625
• Uniprot ID: Q9Y3E5
• Chromosome Location: 17q23.2
• Function: aminoacyl-tRNA hydrolase activity; hydrolase activity