Recombinant Human PTPRC protein(241-310 aa), C-His-tagged

• Cat.No.: PTPRC-2599H
• Product Overview: Recombinant Human PTPRC protein(P08575)(241-310 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 241-310 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 10.5 kDa
• AASequence: YNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILDVPPGVEKFQLHD
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: PTPRC protein tyrosine phosphatase, receptor type, C [ Homo sapiens ]
• Official Symbol: PTPRC
• Synonyms: PTPRC; protein tyrosine phosphatase, receptor type, C; CD45; receptor-type tyrosine-protein phosphatase C; GP180; LCA; T200; CD45 antigen; T200 glycoprotein; leukocyte common antigen; leukocyte-common antigen; T200 leukocyte common antigen; protein tyrosine phosphatase, receptor type, c polypeptide; LY5; B220; L-CA; CD45R
• Gene ID: 5788
• mRNA Refseq: NM_002838
• Protein Refseq: NP_002829
• MIM: 151460
• UniProt ID: P08575