Recombinant Human PTP4A1 protein, GST-tagged

• Cat.No.: PTP4A1-3663H
• Product Overview: Recombinant Human PTP4A1 protein(1-173 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-173 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PTP4A1 protein tyrosine phosphatase type IVA, member 1 [ Homo sapiens ]
• Official Symbol: PTP4A1
• Synonyms: PTP4A1; protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase type IVA 1; PRL 1; PTPCAAX1; PTP(CAAXI); protein-tyrosine phosphatase 4a1; Protein tyrosine phosphatase IVA1; protein tyrosine phosphatase type IVA protein 1; protein-tyrosine phosphatase of regenerating liver 1; HH72; PRL1; PRL-1; PTP(CAAX1); DKFZp779M0721
• Gene ID: 7803
• mRNA Refseq: NM_003463
• Protein Refseq: NP_003454
• MIM: 601585
• UniProt ID: Q93096