Recombinant Human PTP4A1 protein, GST-tagged

Cat.No. : PTP4A1-3663H
Product Overview : Recombinant Human PTP4A1 protein(1-173 aa), fused to GST tag, was expressed in E. coli.
Availability April 27, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-173 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PTP4A1 protein tyrosine phosphatase type IVA, member 1 [ Homo sapiens ]
Official Symbol PTP4A1
Synonyms PTP4A1; protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase type IVA 1; PRL 1; PTPCAAX1; PTP(CAAXI); protein-tyrosine phosphatase 4a1; Protein tyrosine phosphatase IVA1; protein tyrosine phosphatase type IVA protein 1; protein-tyrosine phosphatase of regenerating liver 1; HH72; PRL1; PRL-1; PTP(CAAX1); DKFZp779M0721;
Gene ID 7803
mRNA Refseq NM_003463
Protein Refseq NP_003454
MIM 601585
UniProt ID Q93096

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PTP4A1 Products

Required fields are marked with *

My Review for All PTP4A1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon