Recombinant Rhesus monkey PTHLH Protein, His-tagged

• Cat.No.: PTHLH-3695R
• Product Overview: Recombinant Rhesus monkey PTHLH Protein, His-tagged,expressed in HEK293.

Specification

• Species: Rhesus macaque
• Source: HEK293
• Tag: His
• Protein Length: 25-177 aa
• Tag: His
• Molecular Mass: 19 kDa
• AA Sequence: RSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHSVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRHHHHHHHHH
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.12mg/ml by BCA
• Storage Buffer: Sterile PBS, pH7.4

Gene Information

• Gene Name: PTHLH parathyroid hormone like hormone [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol: PTHLH
• Synonyms: PTHLH; parathyroid hormone-related protein; parathyroid hormone-related protein isoform 1 preproprotein
• Gene ID: 710295
• mRNA Refseq: NM_001261680
• Protein Refseq: NP_001248609
• UniProt ID: H9EU77