Recombinant Human PSMD8

Cat.No. : PSMD8-30431TH
Product Overview : Recombinant fragment of Human PSMD8 with N terminal proprietary tag; Predicted MW 54.27 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 257 amino acids
Description : The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway.An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. A pseudogene has been identified on chromosome 1.
Molecular Weight : 54.270kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTG TKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKC YYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELE RLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPA ESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFF NTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPST ELAKQVIEYARQLEMIV
Sequence Similarities : Belongs to the proteasome subunit S14 family.
Gene Name PSMD8 proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 [ Homo sapiens ]
Official Symbol PSMD8
Synonyms PSMD8; proteasome (prosome, macropain) 26S subunit, non-ATPase, 8; 26S proteasome non-ATPase regulatory subunit 8; HIP6; HYPF; Nin1p; p31; Rpn12; S14;
Gene ID 5714
mRNA Refseq NM_002812
Protein Refseq NP_002803
Uniprot ID P48556
Chromosome Location 19q13.2
Pathway APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PSMD8 Products

Required fields are marked with *

My Review for All PSMD8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon