Recombinant Human PSMD8

• Cat.No.: PSMD8-30431TH
• Product Overview: Recombinant fragment of Human PSMD8 with N terminal proprietary tag; Predicted MW 54.27 kDa.

Specification

• Description: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway.An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. A pseudogene has been identified on chromosome 1.
• Protein length: 257 amino acids
• Molecular Weight: 54.270kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTG TKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKC YYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELE RLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPA ESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFF NTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPST ELAKQVIEYARQLEMIV
• Sequence Similarities: Belongs to the proteasome subunit S14 family.
• Tag: Non

Gene Information

• Gene Name: PSMD8 proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 [ Homo sapiens ]
• Official Symbol: PSMD8
• Synonyms: PSMD8; proteasome (prosome, macropain) 26S subunit, non-ATPase, 8; 26S proteasome non-ATPase regulatory subunit 8; HIP6; HYPF; Nin1p; p31; Rpn12; S14
• Gene ID: 5714
• mRNA Refseq: NM_002812
• Protein Refseq: NP_002803
• Uniprot ID: P48556
• Chromosome Location: 19q13.2
• Pathway: APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem