Recombinant Human PSMD4, His-tagged

• Cat.No.: PSMD4-183H
• Product Overview: Recombinant Human 26S Proteasome Non-ATPase Regulatory Subunit 4/PSMD4 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Val2-Lys377) of Human PSMD4 fused with a 6His tag at the C-terminus.

Specification

• Description: 26S Proteasome Non-ATPase Regulatory Subunit 4 (PSMD4) belongs to the proteasome subunit S5A family. Proteasomes are widely distributed in eukaryotic cells at a high concentrations and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. PSMD4 contains two UIM (ubiquitin-interacting motif) repeats and one VWFA domain. PSMD4 is composed of a core protease, known as the 20S proteasome, capped at one or both ends by the 19S regulatory complex (RC). PSMD4 binds and presumably selects ubiquitin-conjugates for destruction, displaying selectivity for longer polyubiquitin chains. PSMD4 also modulates intestinal fluid secretion.
• Source: HEK293
• Species: Human
• Tag: His
• AA Sequence: MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLT PDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKR LKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGA MLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATTGTEDSDDAL LKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEFGQAESADIDASSAMDTSEPAKEEDD YDVMQDPEFLQSVLENLPGVDPNNEAIRNAMGSLASQATKDGKKDKKEEDKKVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Protein length: 2-377 a.a.

Gene Information

• Gene Name: PSMD4 proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 [ Homo sapiens ]
• Official Symbol: PSMD4
• Synonyms: PSMD4; proteasome (prosome, macropain) 26S subunit, non-ATPase, 4; 26S proteasome non-ATPase regulatory subunit 4; AF; AF 1; Rpn10; S5A; angiocidin; RPN10 homolog; antisecretory factor 1; S5a/antisecretory factor protein; multiubiquitin chain-binding protein; 26S proteasome regulatory subunit S5A; ASF; AF-1; MCB1; pUB-R5
• Gene ID: 5710
• mRNA Refseq: NM_002810
• Protein Refseq: NP_002801
• MIM: 601648
• UniProt ID: P55036
• Chromosome Location: 1q21.2
• Pathway: APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Activation of NF-kappaB in B Cells, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem
• Function: protein binding