Recombinant Human PSMD4, His-tagged

Cat.No. : PSMD4-183H
Product Overview : Recombinant Human 26S Proteasome Non-ATPase Regulatory Subunit 4/PSMD4 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Val2-Lys377) of Human PSMD4 fused with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 2-377 a.a.
Description : 26S Proteasome Non-ATPase Regulatory Subunit 4 (PSMD4) belongs to the proteasome subunit S5A family. Proteasomes are widely distributed in eukaryotic cells at a high concentrations and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. PSMD4 contains two UIM (ubiquitin-interacting motif) repeats and one VWFA domain. PSMD4 is composed of a core protease, known as the 20S proteasome, capped at one or both ends by the 19S regulatory complex (RC). PSMD4 binds and presumably selects ubiquitin-conjugates for destruction, displaying selectivity for longer polyubiquitin chains. PSMD4 also modulates intestinal fluid secretion.
AA Sequence : MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLT PDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKR LKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGA MLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATTGTEDSDDAL LKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEFGQAESADIDASSAMDTSEPAKEEDD YDVMQDPEFLQSVLENLPGVDPNNEAIRNAMGSLASQATKDGKKDKKEEDKKVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Gene Name PSMD4 proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 [ Homo sapiens ]
Official Symbol PSMD4
Synonyms PSMD4; proteasome (prosome, macropain) 26S subunit, non-ATPase, 4; 26S proteasome non-ATPase regulatory subunit 4; AF; AF 1; Rpn10; S5A; angiocidin; RPN10 homolog; antisecretory factor 1; S5a/antisecretory factor protein; multiubiquitin chain-binding protein; 26S proteasome regulatory subunit S5A; ASF; AF-1; MCB1; pUB-R5;
Gene ID 5710
mRNA Refseq NM_002810
Protein Refseq NP_002801
MIM 601648
UniProt ID P55036
Chromosome Location 1q21.2
Pathway APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Activation of NF-kappaB in B Cells, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem;
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PSMD4 Products

Required fields are marked with *

My Review for All PSMD4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon