Recombinant Human PSMD1, GST-tagged

Cat.No. : PSMD1-2026H
Product Overview : Recombinant Human PSMD1(1 a.a. - 110 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes the largest non-ATPase subunit of the 19S regulator lid, which is responsible for substrate recognition and binding. Alternatively spliced transcript variants have been found for this gene.
Molecular Mass : 37.84 kDa
AA Sequence : MITSAAGIISLLDEDEPQLKEFALHKLNAVVNDFWAEISESVDKIEVLYEDEGFRSRQFAALVASKVFYHLGAFE ESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTK
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PSMD1 proteasome (prosome, macropain) 26S subunit, non-ATPase, 1 [ Homo sapiens ]
Official Symbol PSMD1
Synonyms PSMD1; proteasome (prosome, macropain) 26S subunit, non-ATPase, 1; 26S proteasome non-ATPase regulatory subunit 1; P112; Rpn2; S1; 26S proteasome subunit p112; 26S proteasome regulatory subunit S1; 26S proteasome regulatory subunit RPN2; MGC133040; MGC133041
Gene ID 5707
mRNA Refseq NM_002807
Protein Refseq NP_002798
UniProt ID Q99460
Chromosome Location 2q37.1
Pathway AMER1 mutants destabilize the destruction complex; APC/C:Cdc20 mediated degradation of Securin; AXIN missense mutants destabilize the destruction complex
Function enzyme regulator activity

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PSMD1 Products

Required fields are marked with *

My Review for All PSMD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon