Recombinant Human PSMD1, GST-tagged

• Cat.No.: PSMD1-2026H
• Product Overview: Recombinant Human PSMD1(1 a.a. - 110 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes the largest non-ATPase subunit of the 19S regulator lid, which is responsible for substrate recognition and binding. Alternatively spliced transcript variants have been found for this gene.
• Molecular Mass: 37.84 kDa
• AA Sequence: MITSAAGIISLLDEDEPQLKEFALHKLNAVVNDFWAEISESVDKIEVLYEDEGFRSRQFAALVASKVFYHLGAFE ESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTK
• Applications: ELISA; WB-Re; AP; Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PSMD1 proteasome (prosome, macropain) 26S subunit, non-ATPase, 1 [ Homo sapiens ]
• Official Symbol: PSMD1
• Synonyms: PSMD1; proteasome (prosome, macropain) 26S subunit, non-ATPase, 1; 26S proteasome non-ATPase regulatory subunit 1; P112; Rpn2; S1; 26S proteasome subunit p112; 26S proteasome regulatory subunit S1; 26S proteasome regulatory subunit RPN2; MGC133040; MGC133041
• Gene ID: 5707
• mRNA Refseq: NM_002807
• Protein Refseq: NP_002798
• UniProt ID: Q99460
• Chromosome Location: 2q37.1
• Pathway: AMER1 mutants destabilize the destruction complex; APC/C:Cdc20 mediated degradation of Securin; AXIN missense mutants destabilize the destruction complex
• Function: enzyme regulator activity