Recombinant Human PSMA7, His-tagged

• Cat.No.: PSMA7-31004TH
• Product Overview: Recombinant full length Human PSMA7 with N terminal His tag; 268 amino acids with a predicted MWt 30kDa including tag.

Specification

• Description: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. This particular subunit has been shown to interact specifically with the hepatitis B virus X protein, a protein critical to viral replication. In addition, this subunit is involved in regulating hepatitis virus C internal ribosome entry site (IRES) activity, an activity essential for viral replication. This core alpha subunit is also involved in regulating the hypoxia-inducible factor-1alpha, a transcription factor important for cellular responses to oxygen tension. Multiple isoforms of this subunit arising from alternative splicing may exist but alternative transcripts for only two isoforms have been defined. A pseudogene has been identified on chromosome 9.
• Protein length: 248 amino acids
• Conjugation: HIS
• Molecular Weight: 30.000kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.58% Sodium chloride, 20% Glycerol
• Storage: Please see Notes section
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSYDRAITVFSPDGHLFQVE YAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVR KICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVED PVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDG TPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEA IETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKIL NPEEIEKYVAEIEKEKEENEKKKQKKAS
• Sequence Similarities: Belongs to the peptidase T1A family.

Gene Information

• Gene Name: PSMA7 proteasome (prosome, macropain) subunit, alpha type, 7 [ Homo sapiens ]
• Official Symbol: PSMA7
• Synonyms: PSMA7; proteasome (prosome, macropain) subunit, alpha type, 7; proteasome subunit alpha type-7; C6; HSPC; proteasome subunit RC6 1; proteasome subunit XAPC7; RC6 1; XAPC7
• Gene ID: 5688
• mRNA Refseq: NM_002792
• Protein Refseq: NP_002783
• MIM: 606607
• Uniprot ID: O14818
• Chromosome Location: 20q13.33
• Pathway: APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem
• Function: identical protein binding; peptidase activity; protein binding; threonine-type endopeptidase activity